Domain assignment for 2013528367 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 182 PLP-binding barrel 1.44e-55 "Hypothetical" protein ybl036c 0.00066 1ct5 A: Alignments

Protein Sequence Details

Sequence length 183
Comment YNP6_134020 pyridoxal phosphate enzyme, YggS family [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MIAENLKRVREQIAEAALRAGRTPESIKLIAVSKTKPVPAVLEAFEAGQRVFGENYVQEWVTKFADETLQTLPIEWHFVGHLQTNKVRYVAEKIAMIHGVDKLSLAEEISKRAKKHNRTIPILLEVNISAEGSKHGLAPDALFSEAKKIFPLPNVEVKGLMTIASPDREKVKEEFKAMRALFE

Download

Sequence (FASTA)