Domain assignment for 2013526887 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
5 78 Thiolase-like 3.61e-18 Thiolase-related 0.00045 1e5m A:6-255 Alignments

Protein Sequence Details

Sequence length 78
Comment YNP6_119200 3-oxoacyl-(acyl-carrier-protein) synthase [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MQLKRVVVTGLGAVTPLGNDVQSYWNALCNGVSGADFITLFDAEKFKTRFACEVKNFVPENFMDKKDARKIDRFSQLA

Download

Sequence (FASTA)