Domain assignment for 2013525936 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
121 321 Thiolase-like 2.96e-69 Thiolase-related 0.00000649 1j3n A:250-408 Alignments
2 159 Thiolase-like 6.53e-47 Thiolase-related 0.0000279 1j3n A:1-249 Alignments

Protein Sequence Details

Sequence length 323
Comment YNP6_109670 3-oxoacyl-[acyl-carrier-protein] synthase II (EC 2.3.1.41) [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
HINPDRVGVVFASGIGGLITFQNEVTDFARGDGTPRFNPFFIPKMILDIAAGQISMRHNLRGPNFAVVSACASSTNAIMDAFNLIRLGKSDIILTGGSEAVISEAGVGGFNAMKAMSERNDDPKTASRPYDKDRDGFVMGEACGILVLEELENAKARGAKIYCEIAGCGATADAYHITAPHPDGLGAKNVMLAALDDAGMRPDEIDYINTHGTSTPIGDVAEVKAIKQVFGEHAYKLNISATKSMTGHCLGAAGVIEAIASIQAVVHDMVPPTINHFTDDPELEPGLNFTFNKAQQRTVRAALSNTFGFGGHNACVIVKKFSS

Download

Sequence (FASTA)