Domain assignment for 2013525808 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 184 Thiolase-like 1.53e-47 Thiolase-related 0.00000743 1ulq A:3-275 Alignments

Protein Sequence Details

Sequence length 219
Comment YNP6_108390 Acetyl-CoA acetyltransferase [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MNEVFIVDGIRTPIGSLNGSLSQVRTDDLAVIVIKELIKRNPSVDFNQSDDVILGCANQAGEDNRNVARMASLMAGLNPRVPGETVNRLCASGMAAVINAARMIATGDGDLVIAGGVESMTRAPYILSKPSAAFGRDSQLFDSTFGWRFINPVMKEMYGTDSMGETAENLVLRDSISRTDQMLLLYGRKPKPHSSKKKPFCKRNCTCFHTSEKGKSDYF

Download

Sequence (FASTA)