Domain assignment for 2013525668 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
69 333 Thiolase-like 5.89e-37 Thiolase-related 0.00053 1tqy A:219-423 Alignments

Protein Sequence Details

Sequence length 379
Comment YNP6_106990 3-oxoacyl-(acyl-carrier-protein) synthase [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
VENKDEGMRAVFAVSDSIVSPISDDVSDNVDAARHGRSAIALHAPYPHFQQPFAASLFKEIQLISEFTRFESLCIYAVQGALKPLSGELAQHDTLFLLSTTKGNIERLESGVFETMDISPFYSAEKIARYFGYTAHRLVVSNACISGVLAIGIAQQLLAQGSYQHAIVCAADVLSSFVISGFYALGATSNEVCKPFDKNRKGINLGECAAAIVLSTDPALNTFSQRVKVGKGFTTNDANHLSGPSKTGEELAWAIKQVLVQNKISFDDISFVNAHGTGTIFNDEMEAKAFGLSGVSHLPINSFKPLLGHTLGAAGAVESVLVYHSLLQGEIFPSLNFEVPGTSVALHVNQRLTRSSRPCALKTASGFGGCNAAIAFMLD

Download

Sequence (FASTA)