Domain assignment for 2013524610 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
98 200 DHS-like NAD/FAD-binding domain 8.28e-38 Pyruvate oxidase and decarboxylase, middle domain 0.00091 1jsc A:280-460 Alignments
2 96 Thiamin diphosphate-binding fold (THDP-binding) 1.43e-22 Pyruvate oxidase and decarboxylase Pyr module 0.00069 1ybh A:86-280 Alignments

Protein Sequence Details

Sequence length 201
Comment YNP6_96410 Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MIDSTPVVCITGQVFRHLLGSDAFQEVDVISVSLPITKWNFQVTKAEEIPTAFAKAFYIAQSGRPGPVLIDITKNAQNERFDFEYHKCTKIRSYFPRRKVDMNAVEAAATLINQAKKPLMLVGQGVILSKAQEELKTFAEKSGIPVASTLLGLSAFSTKHPLYVGYLGMHGNYGPNIKTNECDVLIAVGMRFDDRVTGDLK

Download

Sequence (FASTA)