Domain assignment for 2013524522 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 46 Cytidine deaminase-like 0.00000000000261 Deoxycytidylate deaminase-like 0.0039 2a8n A:2-131 Alignments

Protein Sequence Details

Sequence length 46
Comment YNP6_95530 tRNA-adenosine deaminase (EC 3.5.4.-) [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MASEHDETWMRIALAEAQAAGEAGEVPIGAVVVLGGRIIGRGGNRV

Download

Sequence (FASTA)