Domain assignment for 2013524185 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
28 126 Thiolase-like 1.87e-22 Thiolase-related 0.0036 1ox0 A:-5-251 Alignments

Protein Sequence Details

Sequence length 169
Comment YNP6_92130 3-oxoacyl-(acyl-carrier-protein) synthase [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MCEVEGYYIDMLENQGNYLEFSDTIDCADYAHRIADYLSIYHHVTTISRACSSSANAIFLSARILRTGMIDVAICGGTDGLTRFTINGFHALKNIDKRPCMPFDADRIGLNLGEAAAYVVILEKEKTIKERRIKPLATLSGFSNFNEAFHPAAPNQEGEGAYQAMKKAM

Download

Sequence (FASTA)