Domain assignment for 2013523435 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
12 263 Bacteriochlorophyll A protein 8.63e-50 Bacteriochlorophyll A protein 0.00000194 4bcl A: Alignments

Protein Sequence Details

Sequence length 264
Comment YNP6_84610 Bacteriochlorophyll A protein. [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
SHRLSLKRCGCLRYWRSKAIDDNIIARKQRLLCGNLFHDLSVRVPLDSEEVIDTWLEMQDAFRNSPNFGDYIKDVWLIGPLWNALEQTGQSLDNIDVYYFSEVEGGEKSRIDFRFAGGGTGIVDSISRWLELFPIDGLGKPVNQGGRVARLQGNFNASVQGVEVKLFVELPGFTVPIEGGKRKILNHPLVPLAHHGIAVNSEPADLAIRFKVSIPKGKKFVETANSFEWDRVAENVRVFTGGRYKAWAEGICKGSYSPFDIFFG

Download

Sequence (FASTA)