Domain assignment for 2013523347 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 120 Thiolase-like 5.76e-30 Thiolase-related 0.001 1ulq A:3-275 Alignments

Protein Sequence Details

Sequence length 120
Comment YNP6_83730 Acetyl-CoA acetyltransferase [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MNAYIVAGYRTAVGKASRGGFRFTRPDDLAADVIKHLVSSIPNFDPAEVDDVIVGNAVPEAEQGMQMGRMISLLSLPINVAGMIINRYCGSGVEAISLASAKIHAGLADCMIAGGTESMS

Download

Sequence (FASTA)