Domain assignment for 2013523289 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
114 313 Thiamin diphosphate-binding fold (THDP-binding) 1.97e-68 Pyruvate oxidase and decarboxylase PP module 0.0000119 1n0h A:461-687 Alignments
1 106 DHS-like NAD/FAD-binding domain 6e-38 Pyruvate oxidase and decarboxylase, middle domain 0.00022 1ybh A:281-459 Alignments

Protein Sequence Details

Sequence length 343
Comment YNP6_83150 acetolactate synthase, large subunit (EC 2.2.1.6) [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
LGMHGTAYANFAVTDCDLLICVGARFDDRVTGKLDEFASRAKVIHIDIDPAEVGKNRVPDVPIVGDVKNVLQDILRRCEELGIQGTPNQTQEWLRLINRWKEEYPLVVPHYADSISPQEVIVEIARQAPHAIYTTDVGQHQMWAAQFLKTGPRRWISSGGLGTMGFGLPAAMGAKVAFPEQEVICISGDASFQMCLQELGTLAQYGINVKTVIVNNGWQGMVRQWQQAFHGERYSCSNMEVGMPDIELLAKAYGIKGIVVNNQDELTDAIAQMLAHNGPVIVDVHVTKDENCYPMVAPGKSNAQMIGLPKQAPKTDVKPVYCSNCGAKNLPSNNFCPECGTKL

Download

Sequence (FASTA)