Domain assignment for 2013522997 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 143 Cytidine deaminase-like 1.84e-51 Deoxycytidylate deaminase-like 0.0000455 2b3j A:1-151 Alignments

Protein Sequence Details

Sequence length 151
Comment YNP6_80220 tRNA-adenosine deaminase (EC 3.5.4.-) [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MYAALQEAIKAFDEDEVPIGAVIVHQNKIISRGYNQIEKLKDATAHAEMIAITSAANRLGNWRLNDCSLYVTLEPCIMCTGAILNSRISEVYFSTYDTKSGACGSIYNIPDENRTNHHLKVYSGLMAEESSSLLRDFFESLRNKPNSSNFT

Download

Sequence (FASTA)