Domain assignment for 2013522568 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
54 256 Thiamin diphosphate-binding fold (THDP-binding) 2.4e-68 Pyruvate oxidase and decarboxylase PP module 0.0000117 1n0h A:461-687 Alignments

Protein Sequence Details

Sequence length 284
Comment YNP6_75900 acetolactate synthase, large subunit (EC 2.2.1.6) [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
VPIVGDVRHVLIDLLRRSQEEGDVRDPERNRPWLNRIARWQEDYPLEVPRYPDNLSPQEVIVELSIQAPNAIYTTDVGQHQMWAAQFLKNGPRRWISSAGLGTMGYGMPAAMGAKVAMPDEEVICISGDASFQMNLQELGTLAEYGIAAKTVIINNGWQGMVRQWQEAFYEERYSASNMQKGMPDFVKLAEAFGVKGMIVRSRDELKGAIAEMLKHDGPVLMDVRVKRDENCYPMVPPGKSNAQMVGLPERKILERAAELITCSSCGAKNVSSNKFCPECGTKL

Download

Sequence (FASTA)