Domain assignment for 2013519871 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 51 Thiolase-like 0.00000273 Thiolase-related 0.0023 1dd8 A:254-406 Alignments

Protein Sequence Details

Sequence length 52
Comment YNP6_48850 3-oxoacyl-[acyl-carrier-protein] synthase I (EC 2.3.1.41) [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MAPNINFENPDEDSEKLKILSEKREEKFDVYLSNSLRLGGTNSSLVLKAWKE

Download

Sequence (FASTA)