Domain assignment for 2013519581 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 170 Thiamin diphosphate-binding fold (THDP-binding) 2.5e-54 Pyruvate oxidase and decarboxylase Pyr module 0.000022 1ozh A:7-187 Alignments
156 249 DHS-like NAD/FAD-binding domain 2.25e-21 Pyruvate oxidase and decarboxylase, middle domain 0.0039 1upa A:198-374 Alignments

Protein Sequence Details

Sequence length 250
Comment YNP6_45950 acetolactate synthase, large subunit (EC 2.2.1.6) [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MNTAELLVRCLENEGVQYVFGLPGEENLHVLEAIKHSSIQFITTRHEQGAAFMADVYGRLTGKAGVCLSTLGPGATNLMTGVADANLDGAPLVAITGQVGTDRMHIESHQYLDLVAMFAPVTKWNKQIVRPSITPEVVRKAFKVAQSEKPGAVHIDLPENIAAMPVEGKPLHKDNIEKTFASFASIRSAAAIISQAVNPIILVGNGAIRDQASDAVTQFATQLNIPVANTFMGKGVIPYTHPLALWAVGW

Download

Sequence (FASTA)