Domain assignment for 2013518685 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 61 DHS-like NAD/FAD-binding domain 0.000000298 Pyruvate oxidase and decarboxylase, middle domain 0.03 2c31 A:195-369 Alignments

Protein Sequence Details

Sequence length 76
Comment YNP6_36940 Acetolactate synthase [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
VRFINLNVMEFDAYKHSALPLVGDARATLEELLPVLAGYRTAPDYQAMAESYNRAWEAEVARIYAYEHQPLLSQAR

Download

Sequence (FASTA)