Domain assignment for 2013517490 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 275 Thiolase-like 5.36e-75 Thiolase-related 0.000000135 1ulq A:3-275 Alignments
277 396 Thiolase-like 4.36e-43 Thiolase-related 0.0000138 1ulq A:276-400 Alignments

Protein Sequence Details

Sequence length 398
Comment YNP6_24960 acetyl-CoA acetyltransferases [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MTNAYIIDAVRSPIGKYGGSLSTVRPDDLLAFTLQALVKRNEKIPADAIEDVIAGCANQAGEDNRDVARMAVLLAGLPISVGGNTVNRLCASGLQAIMDAARAIKCGDGDIYIAAGVESMTRAPFVMGKQDSAFSRKAELFDTTIGWRFINPALAALHYPYSMGETAENVAEKWNISRQAQDEFAYKSQWKYEQAHGLQKFADELIAIEIDLGKGKKMMFEKDEHPRLSPIEKLAELKPAFKKDGTVTAGNASGVNDGAAAMLLASESAVSRYDLSPIAIVKSMAIAGVDPAIMGIGPVPASQKALQRAGLSIQDIGLVELNEAFASQSIACLQELNINPDIVNVNGGAIALGHPLGCSGVRISTTLLHEAKRRNVKYALATMCIGVGQGAAIVYEIL

Download

Sequence (FASTA)