Domain assignment for 2013516408 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 82 YebC-like 3.27e-19 YebC-like 0.00064 1mw7 A: Alignments

Protein Sequence Details

Sequence length 83
Comment YNP6_14120 Uncharacterized conserved protein [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
IDFGMEDIGEDAEGHLIIRSGFNDFGRMSEFLESKGLTPISSDLTRIPTTYVELDEAQEKEVLELVDKLEQDDDVQKVYHNLK

Download

Sequence (FASTA)