Domain assignment for 2013516056 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 144 Cytidine deaminase-like 6.52e-51 Deoxycytidylate deaminase-like 0.0000567 2b3j A:1-151 Alignments

Protein Sequence Details

Sequence length 147
Comment YNP6_10600 tRNA-adenosine deaminase (EC 3.5.4.-) [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MAKALELAVEAGNAGEIPVGAVIVNQHQQIIATGENRKERTQDPTAHAEIVAIRYATHALQDWHLNQCSLYVTLEPCPMCAGAILQARIKTLIYGADDPKTGAIRTVINLPDSPASFHRLEVISGVLQSQCQSLLQDWFRQLRRQKG

Download

Sequence (FASTA)