Domain assignment for 2009623741 from 1_050719N

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
132 313 Trimeric LpxA-like enzymes 1.18e-48 GlmU C-terminal domain-like 0.00000372 1hv9 A:252-452 Alignments
2 197 Nucleotide-diphospho-sugar transferases 4.78e-23 UDP-glucose pyrophosphorylase 0.0000395 1hv9 A:4-251 Alignments

Protein Sequence Details

Sequence length 327
Comment BISONN_40608 glucosamine-1-phosphate N-acetyltransferase (EC 2.3.1.157) [1_050719N]
Sequence
LLTVELDDPTGYGRILRDDQGRVTAIVEHKDASDAQRAIREGNTGILAVPGRRLADWLGRLSNSNAQGEYYLTDVIALAVADGLTIATSQPADAMEVQGANDRRQLAQLERHFQQRAAERLMLQGVTLLDPLRFDQRGQVETGRDVSIDINVILEGRVVLEDGVSIGPNCVIKDSVLKRGAIIKANSHLDGAVIGEGADVGPFARLRPGSELGSKAHVGNFVELKNAHLQAGAKAGHLSYLGDASIGPDSNIGAGTITCNYDGANKFRTEIGADVFVGSNSSLVAPVTLGAGATTAAGSVITADVPEDTLALGAGPASQPKPGWQRT

Download

Sequence (FASTA)