Domain assignment for 2009623453 from 1_050719N

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
7 298 Nucleotide-diphospho-sugar transferases 2.72e-43 glucose-1-phosphate thymidylyltransferase 0.029 1mc3 A: Alignments
214 258 Trimeric LpxA-like enzymes 0.0000895 Serine acetyltransferase 0.043 1t3d A: Alignments

Protein Sequence Details

Sequence length 333
Comment BISONN_40316 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [1_050719N]
Sequence
VPFDRGLKSAGVKHVVLVVGFERQQIERRFGNNFEGIRIDYALQEQALGTGHAVLQAEPFVKGEPFMVLNGDDLLLPDALRDGASCIPSLIVARHDQPQRFGVVEVANGYVHRIHEKPKEAPPKALVSTGAWTLPPEAMDWLKNLRPAEDGEIRLPDIMPNLVQVGLRAVITEDGWMPVTYPWDVLLATKHLLNLWGTERVSELLPPPQVLGEIDPTAELVGNVRVEAGAKIGAGAKIFGPSIIGKGTVISEGCDIVRTVVGENCRIKRGAHLEDCVLLDNVQIGEDAEIEWSVIGDNAVIGNEVKVFSKVPTGITVRSVVKGPLIDTGMERL

Download

Sequence (FASTA)