Domain assignment for gi|549477061|ref|YP_008610755.1| from Bacillus infantis NRRL B-14911

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 340 Nucleotide-diphospho-sugar transferases 1.31e-85 glucose-1-phosphate thymidylyltransferase 0.0000491 1yp2 A:10-316 Alignments
282 364 Trimeric LpxA-like enzymes 0.000000000000022 GlmU C-terminal domain-like 0.014 1yp2 A:317-451 Alignments

Protein Sequence Details

Sequence length 381
Comment glucose-1-phosphate adenylyltransferase [Bacillus infantis NRRL B-14911]
Sequence
MAKTKCVAMLLAGGKGSRLNSLTENLAKPAVPFGGKYRIIDFTLSNCTNSGIDTVGVLTQYQPLVLNSYIGIGSAWDLDRMNGGVTVLPPYAESSEVKWYTGTASAIFQNINYLKQHEPEYVLILSGDHIYKMNYDLMLDYHIEKNADATISVKEVPWEEASRFGIMNTNDDLSIAEFDEKPENPRNNMASMGIYIFKWDVLKEYLELDDLDKDSSHDFGKDIIPRLLNDRKSLYAYPFSGYWKDVGTVQSLWEANMDLLDDDCQLDLNDYSWRIYSVNPNHPPQYIAPMAEVDESMINEGCVIEGEIYKTVLFQGVEVKAGSIIKESVIMPNAVIGKNVFIERAIVPSDMHIPDGTVIRDDENEGEIILVTEEMIKEIHS

Download

Sequence (FASTA)