Domain assignment for gi|549477060|ref|YP_008610754.1| from Bacillus infantis NRRL B-14911

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
24 301 Nucleotide-diphospho-sugar transferases 9.37e-37 glucose-1-phosphate thymidylyltransferase 0.019 1yp2 A:10-316 Alignments
246 325 Trimeric LpxA-like enzymes 5.74e-16 GlmU C-terminal domain-like 0.028 1yp2 A:317-451 Alignments

Protein Sequence Details

Sequence length 342
Comment glycogen biosynthesis protein glgD [Bacillus infantis NRRL B-14911]
Sequence
MNKRLLGVIDATTYHEGLEELIVHRSLAAVPFAGRYRLIDFVLSSMVNSGIASVAIFPKFQYRSLMDHLGSGKNWDLNRKRDGLFFFPSPLLDGPRQGVGSFNHFAANLDYFYRSNQEYSLIANCYTVLNMDFRPALERHIQSGCDITELRHNGKSLEMYLVKTSQLIEFIENRNETGYSCMSDIAADLNHVYKVCAYEYTGHVARIDSIESYYLASMSMLEPETFNKLFRKDQPVYTKVKDEPPARYLKGAGVKNSMVANGCLIEGTVENSIISRAVRIGKGSVVKNCIIMQKCQIGENCILDSVIIDKDVRIESGTVMEGSPVQPIVIRKGTIQGALMNS

Download

Sequence (FASTA)