Domain assignment for ENSGMOP00000010098 from Gadus morhua 69_1

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
8 210 Ribosomal protein S5 domain 2-like 1.9e-57 GHMP Kinase, N-terminal domain 0.00000021 1wuu A:2-216 Alignments
215 386 GHMP Kinase, C-terminal domain 4.52e-53 Galactokinase 0.00000471 1wuu A:217-392 Alignments

Protein Sequence Details

Sequence length 388
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4531:333639:340255:-1 gene:ENSGMOG00000009452 transcript:ENSGMOT00000010371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPVPAVRDVVTEARRLYEQSFLVVVVCAPGRVNLIGEHTDYNDGFVLPMALALVTVVVGSPDPSQAVTVVTANKDVEEPRRVDFYLPNDGSTLSPGQPGWANYVKGVVQHYRASPLPGFKAVIASTVPLGGGLSSSASLEVAMYTFLQQLQPDDGDKVAKAVACQQAEHSHAGVPCGIMDQLVSVLGQEAHALLIDCRSMEATLVPLSDPSVVILITNSNVRHKLTGSEYPTRRKQCMEAAAILGKRSLRDATLQELEDARGRMDQVTYRRALHVIQEIQRTVQGAEALKRGLYEEFGKLMVDSHNSLRDLYEVSCRELDELVSAAMEVKGVYGSRMTGGGFGGCTVTLLQAHVVDRAILHMQERYSGTPTFYVTTPSEGARVLSL

Download

Sequence (FASTA)