Domain assignment for gi|337289033|ref|YP_004628505.1| from Thermodesulfobacterium sp. OPB45

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 188 NAD(P)-binding Rossmann-fold domains 2.27e-52 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.00011 1mv8 A:1-202 Alignments
303 429 UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 8.89e-38 UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 0.0027 1mv8 A:301-436 Alignments
201 297 6-phosphogluconate dehydrogenase C-terminal domain-like 7.65e-34 UDP-glucose/GDP-mannose dehydrogenase dimerisation domain 0.0012 1mv8 A:203-300 Alignments

Protein Sequence Details

Sequence length 435
Comment nucleotide sugar dehydrogenase [Thermodesulfobacterium geofontis OPF15]
Sequence
MHIAVIGAGYVGLVSGACLADFGMKVICVDKDVEKIEKLKKGEVPFYEPGLEELVKKNIKAERLYFTTNLESAVKNSLVIFICVGTPSNPDGSADLTQIKEVALSLAEVIDEYKVIVTKSTVPVGTNRWIKSLIDANKKSDVAVDIISNPEFLREGAAIEDFMHPDRVIIGGESAYAIAIIKDIYRPLYLAETPFIITNLETAELIKYASNAFLATKITFINEIANFCEKVGADVTVVAKGMGLDPRIGPKFLNPGPGFGGSCFPKDVKALVQHGRSISSPFKILEAVLEVNERQKLRAIEKLETYLGDLSGKTIAIFGLSFKPNTSDVRESPALVIVPTLIKKGAKVKVYDPVAMDEFKKAVGDSNIEYSSNPLECAKDSDAIVILTEWNEFRFLDLSQIKKVMRTPVLIDMRNIYEPSIVKKLGFSYSGIGRA

Download

Sequence (FASTA)