Domain assignment for gi|161503109|ref|YP_001570221.1| from Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 162 Ribosomal protein S5 domain 2-like 9.11e-50 GHMP Kinase, N-terminal domain 0.0000000869 1oj4 A:1-163 Alignments
164 280 GHMP Kinase, C-terminal domain 1.22e-33 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.000000831 1oj4 A:164-283 Alignments

Protein Sequence Details

Sequence length 283
Comment 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980]
Sequence
MMTYWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTLHIEPRRDGEIHLLTPVNGVENEDNLIVRAARGLMKAALESGRLPAGSGADISIEKRLPMGGGLGGGSSNAATVLVALNHLWQCGLSVDELAKLGLTLGADVPVFVRGHAAFAEGVGEILTPVNPPEKWYLVAHPGVIIPTPVIFKDPQLPRNTPKRSIDTLLKCEFSNDCEVIARKRFREVDAALSWLLEYAPSRLTGTGACVFAEFDTEPCARQVLEQAPEWLNAFVAKGVNLSPLHRSLL

Download

Sequence (FASTA)