Domain assignment for gi|158313927|ref|YP_001506435.1| from Frankia sp. EAN1pec

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 364 Nucleotide-diphospho-sugar transferases 4.73e-63 glucose-1-phosphate thymidylyltransferase 0.0000115 1yp2 A:10-316 Alignments
301 413 Trimeric LpxA-like enzymes 2.11e-18 GlmU C-terminal domain-like 0.038 1yp2 A:317-451 Alignments

Protein Sequence Details

Sequence length 413
Comment glucose-1-phosphate adenylyltransferase [Frankia sp. EAN1pec]
Sequence
MRSPRVLGLVLAGGAGKRLAPLTADRAKPAVPFGGIYRLVDFVLSNLVNGGYLRIAVLTQYKSHSLDRHITTTWRMSNLLGNYVTPVPAQQRLGPQWFAGSADAIHQSLNLVHDEAPDVVVVFGADHVYRMDPRQMVAQHLETGAGVTVAGLRVPRSEGSAFGVIRTADDGVTIAEFLEKPADPPGLPGSPDEIFASMGNYVFTTDVLIDALRADAADPESVHDMGGSIVPMLVEQGTAAVYDFAANQVPGALERDHGYWRDVGTLDSYFDAHMDLCALDPVFNLYNRDWPIYTNVPPSVPPAKFVHDTPGRVGVATDSIVSNGVIISGGAVRRSVLSPGVRVNSWSVVENAVVMDNSVIGRRAVVRDAILDKNVVVPPGATVGVDKEHDRARGYQVSEAGVTVVGKGVTIAD

Download

Sequence (FASTA)