Domain assignment for gi|241196931|ref|YP_002970486.1| from Bifidobacterium animalis subsp. lactis DSM 10140

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
222 477 Nucleotide-diphospho-sugar transferases 5.16e-25 Exostosin 0.088 1omz A: Alignments

Protein Sequence Details

Sequence length 684
Comment hypothetical protein Balat_1515 [Bifidobacterium animalis subsp. lactis DSM 10140]
Sequence
MAVNTPKKRQTPRHAAAAAQGTGDWETVNRVVFPTSDEDMTMPLYAIEWTRPKLDEDVVNPFADFYSLDFGAMNESELRRLLNGNKRPIANASDAVFTVTGRTAITIHTGRHASFCTYFNAFPASYWRRWTPVRSVRFTAQVKGAGALALMRSTGRGLLHPVETVPIDSPQAFTEVSVEMGMDGLLDGGFFWFDAKATDTSALYIADACWEVPTAQRPNDLHPFSIAITTFNRPSYCLRQLRAIAANADVRARLDTIYCTDQGTDHVCDQPDFDETADELGTQLTYIQQANLGGSGGFSRGMYETLKAGTSAHTLLLDDDAISEPESIIRAVQFADYCNTPTIVGGGMLHLDNRTVMYAQGERVDMREMRMFPAVGAEYNHDYAQFPLRDCPKLHRRFNVDFNGWWLCLIPTACMKQIGLSMPAFIKFDDIEYGLRAKEHGFHTVSLPGVAVWHQAWHDKDPGRTWEEYFNNRNRWVCALLHAEKPSPIMAYQMAYGDANLGLRFIYSGIKLRHIALRDVMRGPQYMLDTVHTQLNTVRELRKGFSDTDLKPNLTDFPEAKAEFEPHAVPKSKAAVQKECFKVVLKSLISRTDGTHDERPAIAVPAKDATWHAFQGQSSVLVTSADGNSASWCRRNNPLFRKQFMRGLYLSKEFFKRWDRLAAEYKAANIASVEHWEQIFRNPR

Download

Sequence (FASTA)