Domain assignment for gi|241196826|ref|YP_002970381.1| from Bifidobacterium animalis subsp. lactis DSM 10140

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
14 244 Nucleotide-diphospho-sugar transferases 9.79e-37 Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.05 1xhb A:95-422 Alignments

Protein Sequence Details

Sequence length 278
Comment glycosyl transferase family protein [Bifidobacterium animalis subsp. lactis DSM 10140]
Sequence
MNDTTARQNLFAGIVTFNPDIELLRKNIEAICAQVDLVIIVDNGSRNLEDIRPLADAHHCKLIPNAQNEGIATALNQIALAGKGDGYSWMLTLDQDSECPPDFCSTLSQFFSMNSRIAIVAPVIQDRDRGIIGHKPAGTYGEVRTCITSGSCTRLSAWEKIGGFDEKLFIDSVDFDFCYRIRKTGYVIIQTREAVLEHSIGEVKKNKLLGIPYSEHSAFRYYYISKNNIYYPLKNRLYLHALRGNARNMRNLLQVLFFEEDKKAKLKQIARGWVNGYK

Download

Sequence (FASTA)