Domain assignment for gi|241196825|ref|YP_002970380.1| from Bifidobacterium animalis subsp. lactis DSM 10140

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 244 Nucleotide-diphospho-sugar transferases 2.55e-29 Spore coat polysaccharide biosynthesis protein SpsA 0.052 1qg8 A: Alignments

Protein Sequence Details

Sequence length 317
Comment putative glycosyltransferase [Bifidobacterium animalis subsp. lactis DSM 10140]
Sequence
MKASVAAGVVLFNPEDINRVQQCIAAILEQTDHVYVFNNGTVDVPLAEDARITYLSENANKGIAYALNRIMECAMKDGHEWVLTMDQDSIVPDGMVDDFRRLIEKDRDKTAIFCPQVIDKRRAYMKTADDNNVIKITKCITSSSCTSTKAWECVGGFDEWLFIDLVDDDFCRRLIASGYTIKRANKWVLDQEFGKIVPKSSRKQQFWIGLSNLLHNKNIAKFSYNKYVSPLRVYYTNRNIIYVNRKLKKYGPVGYINYNCKGYLGFIFCFNLPSLLRARHKGQVLSAIIKGTRAGLKTYPSQWVAPTITEAAKEHNE

Download

Sequence (FASTA)