Domain assignment for gi|241196810|ref|YP_002970365.1| from Bifidobacterium animalis subsp. lactis DSM 10140

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
80 218 Nucleotide-diphospho-sugar transferases 0.00000000000003 Glycosylating toxin catalytic domain-like 0.029 2vl8 A:1-542 Alignments

Protein Sequence Details

Sequence length 310
Comment polysaccharide biosynthesis protein [Bifidobacterium animalis subsp. lactis DSM 10140]
Sequence
MGKLHNIRTKLKRYRKECVSAWRLFGPKLAMEGYLAHTVGIGVDRYYTDLSQATWSTLMEDLPYSMSIPAVDEQQCANAPIWVMWWQGVDNQAPDIIQACVRSIRKHANGHPVHVISKQNLHEYASIDESVVQAAECGEIPMAVLSDIIRCTLLYQHGGAWIDATVYLTDDINPEVFTHPIYSIPVHQKNPTRNWTSYFIASTQGNPLFDYAGRSLTHLVTRGKGIPEYFMLDVMLSVAYTRHAEFTAMIDAIPANNEGRFALSEQMDSTEAQPRIPSSTYINKLTYQIDYPTTVNGKETIYQRLLDGEF

Download

Sequence (FASTA)