Domain assignment for gi|241196799|ref|YP_002970354.1| from Bifidobacterium animalis subsp. lactis DSM 10140

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 285 Nucleotide-diphospho-sugar transferases 3.6e-88 glucose-1-phosphate thymidylyltransferase 0.0000000231 1iin A: Alignments

Protein Sequence Details

Sequence length 296
Comment dTDP-glucose pyrophosphorylase [Bifidobacterium animalis subsp. lactis DSM 10140]
Sequence
MKGIILAGGSGTRLYPLTTVTSKQLLPVYDKPMIFYPLSALMMAGIRDILIISTPKDLPNFERLLGDGSRYGISLQYKVQPSPDGLAQAFLLGEDFIGDDACALVLGDNIFYGNGLGRQLRKAAALEHGATVFGYYVDDPERYGVVEFDKEHKAVSIVEKPEHPASNYAVTGLYFYDNRVVDFAKQVKPSPRGELEITDLNRMYLDDGSLHVQTLGRGYAWLDTGTMDSLFEAGEFVRTVEHAQGLPISVIEEIAYENRWIDRDQLLAAAERYGKSPYGKHLLDVAEHRFLSTIDD

Download

Sequence (FASTA)