Domain assignment for gi|241196797|ref|YP_002970352.1| from Bifidobacterium animalis subsp. lactis DSM 10140

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
10 221 Nucleotide-diphospho-sugar transferases 4.02e-21 Cytidylytransferase 0.059 1h7e A: Alignments

Protein Sequence Details

Sequence length 313
Comment glycosyltransferase [Bifidobacterium animalis subsp. lactis DSM 10140]
Sequence
MVADFRRELPDAVIYVYDNASDDRTSQVAADAGAIVRMAPERGKGNVLRRMLRDIDADRYVLVDGDDTYPAEDVHTLLDTLDQGWDMVVGDRLSSTYFTENKRPFHNTGNRLVRSAINSTFHAQIRDVMSGYRVFDNLFAKAYGVMSNGFEIETEMTIFALDRKLRVTEVPIQYRDRPEGSTSKLSTFSDGAKVLNLIFRLAYENRPLPFFGTLGGIIGGVGLGLALWVCIEFAQTGMVRRFPLLIGSTMLMIIGVIAVFTGLVLAVFARKDRSRFAFAAQTYIAASGRHPSVSEPYRACVDEVSHEPVTDGQ

Download

Sequence (FASTA)