Domain assignment for gi|119872479|ref|YP_930486.1| from Pyrobaculum islandicum DSM 4184

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 341 Nucleotide-diphospho-sugar transferases 4.65e-58 glucose-1-phosphate thymidylyltransferase 0.0023 1yp2 A:10-316 Alignments
335 401 Trimeric LpxA-like enzymes 0.00000000000147 GlmU C-terminal domain-like 0.073 1hv9 A:252-452 Alignments

Protein Sequence Details

Sequence length 407
Comment nucleotidyl transferase [Pyrobaculum islandicum DSM 4184]
Sequence
MVKIAVIPVGGEAVRLKPLTVETSKAMVRFLNRPLIELSILHLAQQGVEEFYFGVRGYHNYRDIYDYFREGEWFYIRYGKGIRIRYMPRVETRGNAEAVLTTLEYYDINEPVLVVQGDNIFRLDIQNMYNFHASKKAFLTIALKEEIENLEEFGVVAVDEDMRILKFVEKPKKREEAPSNLVNTGLYILSEDFRNFFRGEVGQRLYVEGRMDFGKDVIPTCIESGLPVYGYVTKGYWFDIGTPERYLKAVRYLLRHLNSSELEAEEVVSHVYIQGSSLQSKALKEKIGDNIRSNIIRAEGPLLIGRHVQIGAETYLKESVIDNYVIIGEKSSIEESVIMDRTYVGRGVSIRRSIIGRHVYIGDGVVIEDSVIADNVSVGEGAYLKNVKVWPHRTIERGVRLEGFSLI

Download

Sequence (FASTA)