Domain assignment for gi|119872440|ref|YP_930447.1| from Pyrobaculum islandicum DSM 4184

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

	Start Residue	End Residue	Superfamily	Superfamily E-value	Family	Family E-value	Closest structure	View
	5	269	Nucleotide-diphospho-sugar transferases	4.35e-64	Cytidylytransferase	0.012	1tzf A:	Alignments
	207	357	Trimeric LpxA-like enzymes	2.08e-22	GlmU C-terminal domain-like	0.02	1hm9 A:252-459	Alignments

Protein Sequence Details

Sequence length	359
Comment	nucleotidyl transferase [Pyrobaculum islandicum DSM 4184]
Sequence	MAESGIILAGGFATRLRPLSYTKPKPLFPVLGRPVLDWVIEKVAEVTEPVISARYLSNIIKNYVAARWGDRVRVIEEDKPLGDGGAVINVVKSLGLRGPIIVANGDVFTDLSVKSLWEYHKRSGAAVTIALIEVPPDEISRFGIAVLDERGHIKRFVEKPREPIGSNLANAGFYIFEPEAVKEFPESNSGEVKIAKHIIPRLMEKFDIYGYIHRGLWFDIGTYNDYLKANFAALDNCKFCSPEVPGVKIIPPVYMGEGVVIGPGSVIGPYAVIGARSKLGPYVRVKESVLMEGVVAEAGAYIYRSIVGEGVVLGKWVRLIEAVVADGVYVKDEVYVGRGAAVGPNREVEQDVKDGEILP

Download

Sequence (FASTA)

---