Domain assignment for gi|119872440|ref|YP_930447.1| from Pyrobaculum islandicum DSM 4184

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
5 269 Nucleotide-diphospho-sugar transferases 4.35e-64 Cytidylytransferase 0.012 1tzf A: Alignments
207 357 Trimeric LpxA-like enzymes 2.08e-22 GlmU C-terminal domain-like 0.02 1hm9 A:252-459 Alignments

Protein Sequence Details

Sequence length 359
Comment nucleotidyl transferase [Pyrobaculum islandicum DSM 4184]
Sequence
MAESGIILAGGFATRLRPLSYTKPKPLFPVLGRPVLDWVIEKVAEVTEPVISARYLSNIIKNYVAARWGDRVRVIEEDKPLGDGGAVINVVKSLGLRGPIIVANGDVFTDLSVKSLWEYHKRSGAAVTIALIEVPPDEISRFGIAVLDERGHIKRFVEKPREPIGSNLANAGFYIFEPEAVKEFPESNSGEVKIAKHIIPRLMEKFDIYGYIHRGLWFDIGTYNDYLKANFAALDNCKFCSPEVPGVKIIPPVYMGEGVVIGPGSVIGPYAVIGARSKLGPYVRVKESVLMEGVVAEAGAYIYRSIVGEGVVLGKWVRLIEAVVADGVYVKDEVYVGRGAAVGPNREVEQDVKDGEILP

Download

Sequence (FASTA)