Domain assignment for gi|118479984|ref|YP_897135.1| from Bacillus thuringiensis str. Al Hakam

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 301 Nucleotide-diphospho-sugar transferases 3.15e-37 glucose-1-phosphate thymidylyltransferase 0.0043 1yp2 A:10-316 Alignments
251 325 Trimeric LpxA-like enzymes 0.00000000000000402 GlmU C-terminal domain-like 0.023 1yp2 A:317-451 Alignments

Protein Sequence Details

Sequence length 344
Comment glucose-1-phosphate adenylyltransferase [Bacillus thuringiensis str. Al Hakam]
Sequence
MGEKMLGIINATGSFPSLKKVTGHRSLAALPFGGRYRLIDFMLSNMVNSNIHSVAVFTSHKNRSLMDHVGSGKQWDLDRKRDGLFLFPPNCQCDQDEFGSFAHFRRHIDYFLRSREEYVVITNSHLVTALNFQAVLERHIHTAADITEVCHEGVSLQTYVLKKQLLLDLFEAYKDMEQYSLFDVVREKRGKSLHIATYEHTGYVAIIDSIESYYKHSLEILQPAIWKQVFKKEAPIFTKVKDEPPTRYVKGAAVKNTMIANGSIIEGEVENSVVSRSVKIGKGSIVRNSIIMQKSQIGDNCIIDGVIIDKDVKIGDGVVLKGNADEPYVVEKGSVQNSTINSYS

Download

Sequence (FASTA)