Domain assignment for gi|154707653|ref|YP_001424293.1| from Coxiella burnetii Dugway 5J108-111

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
6 193 NAD(P)-binding Rossmann-fold domains 7.49e-46 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0015 1mv8 A:1-202 Alignments
301 427 UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 7.72e-31 UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 0.0046 1mv8 A:301-436 Alignments
199 291 6-phosphogluconate dehydrogenase C-terminal domain-like 3.23e-25 UDP-glucose/GDP-mannose dehydrogenase dimerisation domain 0.011 1mv8 A:203-300 Alignments

Protein Sequence Details

Sequence length 429
Comment UDP-N-acetyl-D-galactosamine 6-dehydrogenase [Coxiella burnetii Dugway 5J108-111]
Sequence
MNAVARKIAVIGLGYVGLPVAVAFSRLQPVIAYDKNSARIRALKQGYDACGEVDSQQLRTCQIDFTDDPDDLAKADFYIVAVPTPIDQSKHPDLSLLLNASETIGRYLKRGDIVVFESTVYPGVTEEECAPVLEKASGLKYGVDFTLGYSPERINPSDKTHRFETITKIVSGSDPETLDIVAHVYGSVITAGIYRAPSIRTAEAAKVIENTQRDLNIALMNELAIIFKRMDIDTQEVLAAAGTKWNFLPFKPGLVGGHCIGVDPYYLTYQAQRYGYNPQVILAGRRINDTMGKYIAEQTIKQMIHAGYTIKGAKVAVLGLTFKENCPDLRNSKVIDIIEELNDYGIECVVHDPLADPEVAKQLYNIDLKSWDEIHDVDSFVLAVAHDQFHQYSLEDYHAKLAHHSIIVDVKNVLNPQDCKSNGITLWRL

Download

Sequence (FASTA)