Domain assignment for gi|529063775|ref|YP_008372938.1| from Cycloclasticus zancles 7-ME

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 195 NAD(P)-binding Rossmann-fold domains 7.45e-42 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0000119 1dlj A:1-196 Alignments
193 289 6-phosphogluconate dehydrogenase C-terminal domain-like 1.04e-30 UDP-glucose/GDP-mannose dehydrogenase dimerisation domain 0.0000205 1dlj A:197-294 Alignments
285 390 UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 8.37e-27 UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 0.0000871 1dlj A:295-402 Alignments

Protein Sequence Details

Sequence length 391
Comment putative UDP-glucose 6-dehydrogenase [Cycloclasticus zancles 7-ME]
Sequence
MKIAIAGAGYVGISLALLLSQRNQVVIFDISAERVTLLKQKKSPIDDADVKQFLKDDSLSLVATNDQYEAYNEADYVIIATPTNYNVDTNAFDTSSIETVVGDVLSINPEAVMVIKSTIPVGYTYKVREQYGTKNILFSPEFLREGKALHDNLYPSRIIVGEKSERARVFAKLLVDGAKLPADEIPILYTHSTEAEGVKLFSNTYLAMRVAYFNELDSYCELHQLDTRQVIEGVGLDPRIGKHYNNPSFGYGGYCLPKDTKQLLSNYQQVPNNLIKAIVDANNTRKDFIAEQIIKTQPKVVGIYRLIMKQGSDNVRSSAVQGIMKRIKAKGIEVIVYEPVLEETSFFNSPVMSNLDSFKSQADLIVANRLSNDLHDVLCKVYTRDLFGNDA

Download

Sequence (FASTA)