Domain assignment for gi|127512103|ref|YP_001093300.1| from Shewanella loihica PV-4

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
16 388 Nucleotide-diphospho-sugar transferases 2.16e-76 glucose-1-phosphate thymidylyltransferase 0.0000209 1yp2 A:10-316 Alignments
306 416 Trimeric LpxA-like enzymes 1.62e-17 GlmU C-terminal domain-like 0.0097 1yp2 A:317-451 Alignments

Protein Sequence Details

Sequence length 424
Comment glucose-1-phosphate adenylyltransferase [Shewanella loihica PV-4]
Sequence
MPNMNPSPRYISNLTRETYALILAGGRGSRLHELTDWRAKPSLYFGGKFRIIDFPLSNCINSGIRRIGVVTQYKSHSLIRHVMRGWGHFKKELGESVEILPASQRYSESWYKGTADAVFQNIDIIRHELPKYVMILSGDHVYRMDYAGLLAAHAESGADMTVSCLEVPVAEAAGAFGVVEVDERNKILGFEEKPELPKHLPENPEMCLASMGNYVFNTEFLFEQLKKDAMNENSDRDFGKDIIPSIIEGHEVYAHPFRSGFTDEEAYWRDVGTLDSFWQANMELLSPTPALNLYDAKWPIWTFQEQLPPAKFVFDDDERRGMAVDSIVSGGCIISGSTVRRSVLFNEVQVCSYSTVENAVVLPDVVVLRHCQIKNAILDRGCIIPEGTVIGHDHDHDRARGFRVSEGGITLVTRDMLGLPVGYE

Download

Sequence (FASTA)