Domain assignment for OGLUM03G07950.3 from Oryza glumaepatula 22

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
6 288 Nucleotide-diphospho-sugar transferases 1.26e-39 glucose-1-phosphate thymidylyltransferase 0.09 1lvw A: Alignments
255 339 Trimeric LpxA-like enzymes 0.00000000000113 UDP N-acetylglucosamine acyltransferase 0.093 2jf2 A:1-262 Alignments

Protein Sequence Details

Sequence length 364
Comment pep:novel chromosome:ALNU02000000:3:5876178:5891087:-1 gene:OGLUM03G07950 transcript:OGLUM03G07950.3 description:""
Sequence
MAASEQRVVAVIMVGGPTKGTRFRPLSLNVPKPLFPLAGQPMVHHPISACRRDKPHGSAGGLYSFRDYIMEDSPSHIVLLNCDVCSSFPLPDMLEAHKKYGGMGTLLVNKVSAESANQFGELVADPETNELLHYTEKPETFVSDLINCGVYIFTPNIFNAIEDVLKQKKDRANLRRVSSFEALHSATKALPADYVRLDQDILSPLAGKKELYTYQTLDFWEQIKTPGMSLRCSGLYLSQFRHTSPHLLASGDGKRSATIIGDVYIHPSAKVHPTAKIGPNVSISANARIGAGARLIHCIILDDVEIMGEGDHNAKLGITILGEAVDVEDEVVVVNSIVLPNKTLNDMPGNSAEKALTITFTYHR

Download

Sequence (FASTA)