Domain assignment for OGLUM03G07950.2 from Oryza glumaepatula 22

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
6 333 Nucleotide-diphospho-sugar transferases 1.74e-43 glucose-1-phosphate thymidylyltransferase 0.081 1lvw A: Alignments
300 384 Trimeric LpxA-like enzymes 0.00000000000144 UDP N-acetylglucosamine acyltransferase 0.093 2jf2 A:1-262 Alignments

Protein Sequence Details

Sequence length 409
Comment pep:novel chromosome:ALNU02000000:3:5876178:5891087:-1 gene:OGLUM03G07950 transcript:OGLUM03G07950.2 description:""
Sequence
MAASEQRVVAVIMVGGPTKGTRFRPLSLNVPKPLFPLAGQPMVHHPISACRREQESITRKMDRIPQGNRCYVDASWEDHVLISLQTALQLQTRYLREDKPHGSAGGLYSFRDYIMEDSPSHIVLLNCDVCSSFPLPDMLEAHKKYGGMGTLLVNKVSAESANQFGELVADPETNELLHYTEKPETFVSDLINCGVYIFTPNIFNAIEDVLKQKKDRANLRRVSSFEALHSATKALPADYVRLDQDILSPLAGKKELYTYQTLDFWEQIKTPGMSLRCSGLYLSQFRHTSPHLLASGDGKRSATIIGDVYIHPSAKVHPTAKIGPNVSISANARIGAGARLIHCIILDDVEIMGEGDHNAKLGITILGEAVDVEDEVVVVNSIVLPNKTLNDMPGNSAEKALTITFTYHR

Download

Sequence (FASTA)