Domain assignment for gi|417359302|ref|YP_002935228.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
53 318 Glycerol-3-phosphate (1)-acyltransferase 1.44e-25 Glycerol-3-phosphate (1)-acyltransferase 0.012 1k30 A: Alignments

Protein Sequence Details

Sequence length 333
Comment acyltransferase [Edwardsiella ictaluri 93-146]
Sequence
MSGTKCADLRLYLLTLQILFFRVRCDFPMPTLTATVLSPFTFVLITLLAIVVTMACSLPIVLLGVIKLLLPLPGVRHAISRYSDRLMWCWCQGLAGLMNLNPRLKWHVSGLEGLSKQNWYLLISNHNSWTDIVVLCVLLRNHIPMNKYFLKQQLAWVPFIGLACWALDMPFMRRYSRSYLLKHPELRGKDIETTRRSCEKFRLHPTTIVNFVEGSRCTEEKRRGQNSPYQNLLQPKAAGIAFTLSTLGSQFERVLNVTLLYPQNERRPFLDLLCGRMQGIVVHVEILPISDEIRGDYFNNKDFKHQFQLWLNTLWQRKDLLITRLRERYRPTV

Download

Sequence (FASTA)