Domain assignment for gi|417359295|ref|YP_002935142.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 113 Ribonuclease H-like 0.00000000000000288 Retroviral integrase, catalytic domain 0.017 1asu A: Alignments

Protein Sequence Details

Sequence length 126
Comment putative transposase [Edwardsiella ictaluri 93-146]
Sequence
MRQHLRSTDVAGMLDSIAHRRPLPQVLKADNGSEFAGNILDRWVYESGIGVSRPGTPADNATVGSFNGRLRQAGLNENGFISLVDERCKIEAWRIHDNQRRPHCEPGWIPSAFAEKSAGCQNMQPE

Download

Sequence (FASTA)