Domain assignment for gi|417359281|ref|YP_002935044.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
95 271 Rhomboid-like 4.45e-40 Rhomboid-like 0.000000662 2ic8 A:91-272 Alignments

Protein Sequence Details

Sequence length 276
Comment peptidase, S54 (rhomboid) family [Edwardsiella ictaluri 93-146]
Sequence
MVRVITLPNPRLAQAFIDYMATQGVRLEAESGSQGVALWLADDSRLAQVEQELQRFLQAPQHPRYQAASWQSGSTHSGLRYARFGYLRSFARQSGPLTIGVTLLCILVYLLQLALGDGAVMAYLAWPADAAQHYQLWRYFTPALLHFSPLHIIFNLMWWWYLGGQVEKRLGAAKLAQIALVSALMSAWAQSLFSGIFFGGLSGVVYALMGYVWWCGERAPQFGVAMPRGLMLFSLLWLVAGYFNWFGLAIANAAHAGGLVIGLLMAFWDMRHFRRQ

Download

Sequence (FASTA)