Domain assignment for gi|417359276|ref|YP_002934987.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 169 P-loop containing nucleoside triphosphate hydrolases 5e-33 Shikimate kinase (AroK) 0.000000117 1kag A: Alignments

Protein Sequence Details

Sequence length 172
Comment shikimate kinase [Edwardsiella ictaluri 93-146]
Sequence
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFFDSDQEIERRTGADVSWVFDVEGEEGFRDREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKRPLLQVDTPREVLEQLAQERNPMYEEIADVTIRTDEQSAKVVANQIIHLLENN

Download

Sequence (FASTA)