Domain assignment for gi|417359269|ref|YP_002934944.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 101 Glucocorticoid receptor-like (DNA-binding domain) 2.35e-37 Ribosomal protein S14 0.0000034 2qal N:1-100 Alignments

Protein Sequence Details

Sequence length 101
Comment ribosomal protein S14p/S29e [Edwardsiella ictaluri 93-146]
Sequence
MAKQSMKAREVKRVKLADKFFAKRVELKAIISDVNVSDEDRWNAVLKLQTLPRDSSPSRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKASW

Download

Sequence (FASTA)