Domain assignment for gi|417359253|ref|YP_002934769.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
9 409 MFS general substrate transporter 1.44e-31 Glycerol-3-phosphate transporter 0.098 1pw4 A: Alignments

Protein Sequence Details

Sequence length 420
Comment nucleoside transporter family protein [Edwardsiella ictaluri 93-146]
Sequence
MNLKLQLKVLSFLQFYLWGSWLTTLGSYMFVTLKFDGAAIGAVYSSLGIAALFMPTLLGIVADKWVSAKWVYAACHLVGALTLFLAAQVTTPSAMFVVILLNSLAYMPTLGLVNTISYYRLQNAGMDIVRDFPPIRIWGTIGFILAMWAVSFSGFELSYMQLYIGAVASLLLGLFAMTLPTIPVTKSQEKQGWVEMLGLNAFSLFKIPRMAIFFIFAMLLGAELQITNMFGNPFLHSFDQNPLFSGSFIVEHASVLLSVSQISETVFILTIPFFLGRYGIKNVMLMSMVAWMLRFGLFAYGDPSPFGTVLLVLSMIVYGCAFDFFNISGSVFVDQEVKPAIRASAQGMFLMMTNGFGCILGGIVSGKVVEYYTHSGVTDWPTVWLIFAGYSLLLAVIFLFLFRYRYVRPQGQNTAVCQEA

Download

Sequence (FASTA)