Domain assignment for gi|417359250|ref|YP_002934749.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
18 453 MFS general substrate transporter 6.02e-78 LacY-like proton/sugar symporter 0.092 1pv7 A: Alignments

Protein Sequence Details

Sequence length 468
Comment MFS transporter, sugar porter family protein [Edwardsiella ictaluri 93-146]
Sequence
MSTPVNTSTVHHARSNAGMTFFVCFLAALAGLLFGLDIGVIAGALPFITDTFNITSSQQEWVVSSMMFGAAVGAVGSGWMNHRMGRKYSLMIGAILFVVGSLCSAFAPNVDILILSRILLGLAVGIASYTAPIYLSEIAPERIRGSMISMYQLMITIGILGAYLSDTAFSYTGSWRWMLGVITIPAIVLLLGVFFLPDSPRWLASRNRHEQARQVLEKLRDSSQQAQDELNDIRDSLKLKQSGWTLFLQNSNFRRAVYLGILLQVMQQFTGMNVIMYYAPKIFDLAGFASTEQQMWGTVIVGLVNVLATFIAIGLVDRWGRKPTLILGFIVMAIGMGTLGTMMNIGITSSMVQYFAIVMLLLFIVGFAMSAGPLIWVLCSEIQPLKGRDFGITCSTATNWIANMIVGATFLTMLNNLGSAHTFWVYAALNLIFVFITLALIPETKNISLEHIERNLMAGKSLRNIGSR

Download

Sequence (FASTA)