Domain assignment for gi|417359245|ref|YP_002934702.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
17 183 OMPA-like 2.88e-20 Outer membrane protein 0.00047 1qj8 A: Alignments

Protein Sequence Details

Sequence length 183
Comment enterobacterial Ail/Lom family protein [Edwardsiella ictaluri 93-146]
Sequence
MSGVMASPAALAAEQTASIGYAHAQLQDVGNLNGFTLQYRYEWDTLWSVIGGLSYMQGSNNNAYQDAWGDTYKTDINAKYTSLLLGPAYRINDYVSVYGLLGAAYTKMDGSYEWRNSVGADTPNGHLSITSSSQAVKLAYAAGVVINPINTLSINIGYEGSQADLYGGNKTINGFTVGIGWRF

Download

Sequence (FASTA)