Domain assignment for gi|417359236|ref|YP_002934627.2| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
80 313 Duplicated hybrid motif 4.97e-53 Peptidoglycan hydrolase LytM 0.0015 1qwy A: Alignments

Protein Sequence Details

Sequence length 316
Comment peptidase M23B, putative [Edwardsiella ictaluri 93-146]
Sequence
MSMGSPMIKWRRVAVCTLVTMWLAGCSSSNSSAPISSVNGSGGGRMLSSSGRVQTDARGHIVYNRSYQSIPKGSYNGEAYTVKRGDTLFYIAWITGSDFRDLAVRNNIQAPYSLNVGQVIRIGGNGGGGMLASNNIVPVQPSSAQIQTTNVDSKSASAYSDPSGKQNVGRMLPAAGVASAAPAVSASSSSSAPVGTWRWPTDGKIIENFSSAEGGNKGIDIAGSRGQPVQATADGRVVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGASSVRLHFEIRYKGKSVNPLQYLPQR

Download

Sequence (FASTA)